PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC010491.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 512aa    MW: 56449.9 Da    PI: 5.085
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC010491.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-183683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
     EcC010491.30 36 KGPWTAAEDAILVDYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 83
                     79******************************************9986 PP

2Myb_DNA-binding50.16.2e-1689132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ l++++++++G++ W++ a++++ gRt++++k++w++
     EcC010491.30  89 KGAFSPEEERLIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 132
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7633183IPR017930Myb domain
SuperFamilySSF466892.55E-3033130IPR009057Homeodomain-like
SMARTSM007179.2E-143585IPR001005SANT/Myb domain
PfamPF002492.7E-153683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-243790IPR009057Homeodomain-like
CDDcd001672.31E-113883No hitNo description
PROSITE profilePS5129425.9184138IPR017930Myb domain
SMARTSM007171.2E-1688136IPR001005SANT/Myb domain
PfamPF002493.1E-1589132IPR001005SANT/Myb domain
CDDcd001672.85E-1291132No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2591136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0016151Molecular Functionnickel cation binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MRSTTDGGRD KKVRKIRRHP PSGEEASDGG GIPLKKGPWT AAEDAILVDY VTKHGEGNWN  60
AVQKHSGLAR CGKSCRLRWA NHLRPDLKKG AFSPEEERLI IELHAKMGNK WARMAAELPG  120
RTDNEIKNYW NTRIKRLQRT GMPIYPTEVC LQVSSENQET HNMGNLHTAG EDNCDLSQAD  180
PLEIPEVDFR KLELHLGFSS FWSTLLDVPP CGFGREAMCL SDAYCLPFPS SRSPKRLRGS  240
ETPFPVLDAG SNDSFSSFGQ YADYSSEITP ESFVLSSPYD VNPDSTNQSL LGDLPGSHAF  300
LNGNYPSSVP HLEAMKSELP SLQYTETQQS SCGTPASPRP SLEFIDPLIQ SPPCEHYQSD  360
CHSPRGCGLL EAVIYEAFSK QKSCAQTTVV SGNEACNSSP VQLRTKQEVY AAPDSPLGDN  420
AISVLNHCSP ASRKSFEEPQ SANTMPGFDI KPEEDSKTFP DFEGKQEILD QMHINGPDAL  480
LDLDWCQGKS QPSEDKIGRA DYIGALLGTD FY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32311361106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045104.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A059D9S40.0A0A059D9S4_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s02380.11e-153(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.33e-86myb domain protein 33